PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN33279.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YA
Protein Properties Length: 292aa    MW: 32736.7 Da    PI: 8.6407
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN33279.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA98.28.5e-31172228158
   CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                 +ep+YVN+KQy++Il+RRq Rakle+ +k  +k rkpylheSRh+hAl+R+Rg gGrF
  KHN33279.1 172 EEPIYVNSKQYHAILRRRQYRAKLEALNKP-IKDRKPYLHESRHQHALKRARGAGGRF 228
                 69***************************9.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.1E-34170231IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.164171231IPR001289Nuclear transcription factor Y subunit A
PfamPF020459.1E-26173228IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006169.6E-24174196IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860176196IPR018362CCAAT-binding factor, conserved site
PRINTSPR006169.6E-24205228IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MNCLCEKDSG LFSSHSTAPY VLGCPSWATS EFEVQRSSMS RSLSSKVDVL PQQCHNSKTF  60
NFQFQEQDAS STKSTDQSYP EVGQISVQHS STDSTLIRNE GKSMGCVIRS FMGSQDFPFP  120
PPLLDHRPIL AHIACHYADP CYSGLVAAAY SPQSKPVETA PVRIPLQLDF AEEPIYVNSK  180
QYHAILRRRQ YRAKLEALNK PIKDRKPYLH ESRHQHALKR ARGAGGRFLN TKKQLQSNHT  240
PGNIAESKMH HIENYRDGAD VSYAFNSDAR NMQNDAADKG GGTTQHPLFV YM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A6e-21172234264NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2353121e-139AC235312.1 Glycine max strain Williams 82 clone GM_WBb0071J06, complete sequence.
GenBankEU0283141e-139EU028314.1 Glycine max clone BAC gmw1-6b18 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006597203.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X2
TrEMBLA0A0B2RLW70.0A0A0B2RLW7_GLYSO; Nuclear transcription factor Y subunit A-3
STRINGGLYMA15G03175.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101202541
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.14e-46nuclear factor Y, subunit A3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]